Paste a sequence and submit
Pick any tool, paste a FASTA sequence or upload a PDB, adjust settings if you want, and hit Submit. No scripts, no command line.
Input
>GFP_Aequorea
MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPW...
Run AlphaFold2, Boltz-2, RFdiffusion3, and 50+ other tools from your browser.
Used by researchers from organizations including Harvard, the University of Cambridge, Roche, and Thermo Fisher.
Pick any tool, paste a FASTA sequence or upload a PDB, adjust settings if you want, and hit Submit. No scripts, no command line.
>GFP_Aequorea
MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPW...
Every tool ships with pre-computed example jobs. Click "Try it" to see real results instantly — no credits, no waiting.
Human Ubiquitin (76 aa) - Nobel Prize 2004
Try itGreen Fluorescent Protein (238 aa) - Nobel Prize 2008
Try itSee what you ran, when it finished, how many credits it cost, and how long it took. Reload any past result in one click.
2m ago
Input: 238aa · Credits: 100 · Processing: 47.21s
8m ago
Input: 1 ligand · Credits: 20
14m ago
Input: 110aa · Credits: 50 · Processing: 12.38s
22m ago
Input: 76aa · Credits: 100 · Processing: 38.54s
Elapsed time ticks live while your prediction runs. An estimated time remaining updates as the job progresses.
Used by researchers at Harvard, Stanford, Thermo Fisher, Cambridge, and 40+ institutions worldwide.
Files are processed and deleted. We don't store your sequences or structures beyond your session.
Jobs run on NVIDIA B200, H200, & A100 GPUs. Get results in minutes, not days.
Upload your data, click run, download results. No installation, no dependencies, no waiting.