Paste a sequence and submit
Pick any tool, paste a FASTA sequence or upload a PDB, adjust settings if you want, and hit Submit. No scripts, no command line.
Input
>GFP_Aequorea
MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPW...
From predicting structures with AlphaFold 2 and Boltz-2 to generating binders with BoltzGen. All running on A100, H200, & B200 GPUs.
Pick any tool, paste a FASTA sequence or upload a PDB, adjust settings if you want, and hit Submit. No scripts, no command line.
>GFP_Aequorea
MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPW...
Every tool ships with pre-computed example jobs. Click "Try it" to see real results instantly — no credits, no waiting.
Human Ubiquitin (76 aa) - Nobel Prize 2004
Green Fluorescent Protein (238 aa) - Nobel Prize 2008
See what you ran, when it finished, how many credits it cost, and how long it took. Reload any past result in one click.
| Job Name | Status | Duration | Analysis | |
|---|---|---|---|---|
| GFP structure prediction | Finished | 47.2s (2m ago) | HighFold | |
| KRAS docking — saquinavir | Processing | Running for 38s | AutoDock Vina | |
| Insulin fold | Finished | 12.4s (14m ago) | HighFold | |
| Ubiquitin prediction | Finished | 38.5s (22m ago) | ESMFold |
Elapsed time ticks live while your prediction runs. A tip carousel keeps you company while you wait.
Used by researchers at Harvard, Stanford, Thermo Fisher, Cambridge, and 40+ institutions worldwide.
Files are processed and deleted. We don't store your sequences or structures beyond your session.
Jobs run on NVIDIA B200, H200, & A100 GPUs. Get results in minutes, not days.
Upload your data, click run, download results. No installation, no dependencies, no waiting.