ProteinIQ
Sign inStart for free
ProteinIQ

Bioinformatics in your browser

Fold, design, dock, and simulate with 240+ published tools. No installs, no command line, no GPUs to rent.

Start for freeContact sales

Free plan with 100 credits. Upgrade when you need more.

The ProteinIQ workspace showing a protein folding result with a predicted structureThe ProteinIQ workspace showing a protein folding result with a predicted structure

Used by researchers at universities, biotech startups, and pharmaceutical companies worldwide

Researchers
11,700+
Jobs run
25,000+
Scientific tools
243
Institutions
40+

From sequence to result in three steps

Skip the environment setup, dependency conflicts, and GPU queues. Pick a method, add your data, and read the results in the same place.

  1. ligand binding
    • Boltz-2Complex structure and affinity
    • AutoDock VinaPhysics-based docking
    • GNINADocking with CNN scoring
    • Chai-1Biomolecular complex prediction
    Step 1

    Choose a tool

    Find the right method for your question, from structure prediction and protein design to docking and sequence analysis.

  2. ProteinPasteUploadPDBUniProt

    MTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQE

    LigandCCD code

    U4U

    Samples5
    Cost 50 creditsRun
    Step 2

    Add your data

    Paste a sequence, upload files, or fetch from PDB, UniProt, and PubChem. Adjust settings, see the credit cost, and submit.

  3. Pose 1 of 5
    pTM
    0.975
    ipTM
    0.979
    pLDDT
    0.961
    Step 3

    Explore the results

    Inspect structures and scores in an interactive viewer, download every output file, or send results to the next tool.

240+ tools, from folding to simulation

The open source methods you know from the literature, set up and running on GPUs. Pick one to try it with your own data.

Boltz-2AlphaFold2Chai-1FoldingRFdiffusionProteinMPNNBindCraftDesignAutoDock VinaDiffDock-LGNINADockingGROMACSOpenMMMDGenSimulationADMET-AIPAINS filterfpocketScreeningMAFFTFoldSeekMMseqs2AlignmentMolProbityESM-2PLIPAnalysisPDBFixerOpen BabelFASTA splitterUtilities
ProteinIQ
  • Folding ↗

    • Boltz-2
    • AlphaFold2
    • Chai-1
  • Design ↗

    • RFdiffusion
    • ProteinMPNN
    • BindCraft
  • Docking ↗

    • AutoDock Vina
    • DiffDock-L
    • GNINA
  • Simulation ↗

    • GROMACS
    • OpenMM
    • MDGen
  • Screening ↗

    • ADMET-AI
    • PAINS filter
    • fpocket
  • Alignment ↗

    • MAFFT
    • FoldSeek
    • MMseqs2
  • Analysis ↗

    • MolProbity
    • ESM-2
    • PLIP
  • Utilities ↗

    • PDBFixer
    • Open Babel
    • FASTA splitter
Browse all 243 tools

Connect tools into workflows

Chain structure preparation, docking, and validation into one pipeline. Results pass between steps automatically, and you see the total cost before anything runs.

Build a workflow
A multi-step docking workflow in the ProteinIQ editorA multi-step docking workflow in the ProteinIQ editor

From one run to your whole pipeline

Start with a single job in the browser. When the project grows, the same tools scale to batches, code, and guided analysis.

  • Boltz-2 batch2 of 5 done
    • KRAS_G12C.fastaCompleted
    • KRAS_G12D.fastaCompleted
    • KRAS_G12V.fastaRunning
    • KRAS_Q61H.fastaQueued
    • KRAS_Q61L.fastaQueued

    Run hundreds of inputs at once

    Apply one tool across a set of sequences or molecules. Track every job and keep the results together.

    Run a batch
  • POST /api/v1/jobs202 Accepted
    {
      "tool": "boltz-2",
      "inputs": ["protein.fasta"],
      "settings": { "samples": 5 }
    }
    
    → { "id": "job_01JX7K2",
        "status": "queued",
        "credits": 50 }

    Script it through the API

    Discover tools, estimate costs, submit jobs, and fetch results from your own pipelines and notebooks.

    Explore the API
  • The ProteinIQ assistant writing a methods section for a Boltz-2 jobThe ProteinIQ assistant writing a methods section for a Boltz-2 job

    Ask the AI assistant

    Interpret results, troubleshoot runs, and draft methods sections. Follow-up jobs wait for your approval.

    Try the assistant

Built for research you can publish

Hosted tools run the authors’ published code, not a reimplementation. You know exactly what ran, what to cite, and where your data went.

How we protect your data

Boltz-2

Structure and binding affinity prediction

v2.2.1
Source
github.com/jwohlwend/boltzThe authors’ open source code, MIT license
Version
boltz 2.2.1Pinned, so reruns use the same release
Cite
Wohlwend J, Corso G, Passaro S, et al. Boltz-2: Towards accurate and efficient binding affinity prediction. bioRxiv, 2025.doi:10.1101/2025.06.14.659707
Compute
Isolated GPU containerEncrypted in transit and at rest
Your data
Private to your workspaceNever used for AI training or shared with third parties
Cost
From 50 credits, shown before you submitRefunded automatically if the job fails
Boltz-2 shown as an example. Hosted tool pages link their source, version, and paper.

Used and cited by researchers

Peer-reviewed papers, public posts, and editorial coverage that mention ProteinIQ.

  • Dr Uzma Saqib

    Scientist

    in

    The docking interface is easy and trustworthy.

    View on LinkedIn
  • Zong-Nan Li et al.

    Antibiotics · 2026

    A study screening insect-derived antimicrobial peptides used ProteinIQ’s Chou–Fasman tool to predict peptide secondary structure.

    Research preview from Zong-Nan Li et al.Published research
  • ParaSurf

    Official project repository

    ParaSurf is live on proteinIQ.io!

    View on GitHub
  • Asma Zafar

    Biotechnology graduate

    in

    Having separate tools integrated into one single dashboard made it incredibly straightforward to manage the entire workflow

    View on LinkedIn
  • Jingjing Tie et al.

    Published research · 2026

    Researchers used ProteinIQ’s Protenix server to predict a Coa6–CoQ10 complex in a study of neuronal mitochondrial dysfunction and working memory.

    Research preview from Jingjing Tie et al.Published research
  • FC

    Farid Castro

    HTGAA · Community project

    I performed reverse translation with the help of ProteinIQ

    View on HTGAA
  • Andrii Buvailo

    BiopharmaTrend · Editorial coverage

    An overview of diffusion models in drug discovery features ProteinIQ and its browser-based workflow for running molecular design tools.

    From BiopharmaTrend
  • Plant-derived peptides

    Published research · 2025

    Researchers used ProteinIQ to calculate physicochemical properties of plant-derived peptides, including theoretical pI, instability index, aliphatic index, and GRAVY.

    Published research
  • Muñoz-Tafalla et al.

    Microbial Biotechnology · 2026

    A study of PET-hydrolysing enzymes cites ProteinIQ’s SASA calculator in its supporting information for comparing active-site accessibility.

    Published research

Have something to share? Tell us about your experience.

A word from the founder

Scientists should be able to try a promising computational method without first becoming experts in installing and running it. Yet trying a tool from a paper can mean days of software setup, finding GPU access, and moving files between analyses.

We’re building ProteinIQ so you can get right to researching. Start with a sequence, predict its structure, and explore potential binding partners. Design variants, compare candidates, and investigate their behavior with molecular dynamics. Use what you learn to choose your next experiment and share with your teammates.

240+ bioinformatics tools share one browser-based workspace. Run a single analysis, test candidates in batches, or connect tools into workflows. Your files and results stay together in the cloud, ready for the next question.

Our aim is to shorten the distance between reading about a method and using it to investigate your own question.

Matic Broz, PhDFounder, ProteinIQ

Questions

Something else on your mind? Get in touch.

ProteinIQ is a browser workspace for running 240+ bioinformatics tools, including structure prediction, protein design, molecular docking, molecular dynamics, and sequence analysis. Your files, jobs, and results live in one place, and tools can be chained into workflows or run in batches.

No. Lightweight tools run directly in your browser, and heavier models run on cloud GPUs that we manage. You only need a web browser.

The Free plan includes 100 credits and up to 3 jobs per day, and tools that run in your browser cost 0 credits. Paid plans add monthly credits, batches, and higher limits.

See pricing for plan details.

Yes. Your sequences, structures, and results are never used for AI training or shared with third parties. Jobs run in isolated containers, and data is encrypted in transit and at rest.

Read more on our security page.

Commercial use requires a Pro or Enterprise plan. For team procurement, security reviews, or custom compute, talk to sales.

Credits for jobs that end in Failed or Timeout are refunded automatically.

Yes. The ProteinIQ API lets you discover tools, estimate costs, submit jobs, and retrieve results from scripts, notebooks, and pipelines.

Run your first analysis today

Start with 100 free credits and no installs. Upgrade when your project needs more compute.

Start for freeView pricing
ProteinIQ

© 2026 ProteinIQ

Products

  • Bioinformatics tools
  • Workflows
  • Batches
  • PDB viewer
  • API

Solutions

  • Small molecule
  • RNA discovery
  • Antibody engineering
  • Peptide discovery
  • Enzyme engineering
  • Protein engineering
  • Virtual screening
  • Molecular docking
  • Protein structure prediction
  • RNA structure prediction
  • Protein structure alignment
  • Protein design
  • Sequence alignment
  • Phylogenetic analysis
  • Molecular dynamics simulation
  • For academia
  • For enterprise

Resources

  • Documentation
  • Blog
  • Guides
  • Datasets
  • Changelog
  • Sitemap

Company

  • About
  • Contact
  • Enterprise
  • Pricing
  • Security
  • Trust center
  • Author
  • Legal
  • Terms
  • Privacy policy

Connect

  • LinkedIn
  • X
  • Discord
  • Pricing