The bioscience platform built for scientists

Run AlphaFold2, Boltz-2, RFdiffusion3, and 190+ other tools from your browser.

Chai-1

EGFR kinase with gefitinib (cancer drug target)

The latest state-of-the-art models. From predicting structures with AlphaFold 2 and Boltz-2 to generating binders with BoltzGen. All running on A100, H200, & B200 GPUs.

Paste a sequence and submit

Pick any tool, paste a FASTA sequence or upload a PDB, adjust settings if you want, and hit Submit. No scripts, no command line.

Input

GFP structure prediction

>GFP_Aequorea
MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPW...

Prediction parameters
100
450
Submit

Try examples before committing your own input

Every tool ships with pre-computed example jobs. Click "Try it" to see real results instantly — no credits, no waiting.

Output

ViewerDataFiles
Configure input settings on the left, then click "Submit"orTry an example (it's free)

Human Ubiquitin (76 aa) - Nobel Prize 2004

Try it

Green Fluorescent Protein (238 aa) - Nobel Prize 2008

Try it

Every job saved with full metadata

See what you ran, when it finished, how many credits it cost, and how long it took. Reload any past result in one click.

Job NameStatusDuration
GFP structure predictionFinished47.2s (2m ago)
KRAS docking — saquinavirProcessingRunning for 38s
Insulin foldFinished12.4s (14m ago)
Ubiquitin predictionFinished38.5s (22m ago)

Watch your job compute in real time

Elapsed time ticks live while your prediction runs. A tip carousel keeps you company while you wait.

Output

Computing... (1m 23s)
ProteinIQ tips
HighFold uses ESMFold as its backbone, which means predictions for single chains under 400 residues are typically fast and reliable.

Built by scientists for scientists

Trusted by leading institutions

Used by researchers at Harvard, Stanford, Thermo Fisher, Cambridge, and 40+ institutions worldwide.

Your data stays yours

Files are processed and deleted. We don't store your sequences or structures beyond your session.

GPU acceleration

Jobs run on NVIDIA B200, H200, & A100 GPUs. Get results in minutes, not days.

No setup, no queues

Upload your data, click run, download results. No installation, no dependencies, no waiting.

Frequently asked questions

Try ProteinIQ now.

No credit card required