The bioscience platform built for scientists

Run AlphaFold2, Boltz-2, RFdiffusion3, and 50+ other tools from your browser.

Chai-1

EGFR kinase with gefitinib (cancer drug target)

The latest state-of-the-art models. From predicting structures with AlphaFold 2 and Boltz-2 to generating binders with BoltzGen. All running on A100, H200, & B200 GPUs.

Paste a sequence and submit

Pick any tool, paste a FASTA sequence or upload a PDB, adjust settings if you want, and hit Submit. No scripts, no command line.

Input

History
GFP structure prediction

>GFP_Aequorea
MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPW...

Prediction parameters
100 / 450
Reset
Submit

Try examples before committing your own input

Every tool ships with pre-computed example jobs. Click "Try it" to see real results instantly — no credits, no waiting.

Output

ViewerDataFiles
Configure input settings on the left, then click "Submit"orTry an example (it's free)

Human Ubiquitin (76 aa) - Nobel Prize 2004

Try it

Green Fluorescent Protein (238 aa) - Nobel Prize 2008

Try it

Every job saved with full metadata

See what you ran, when it finished, how many credits it cost, and how long it took. Reload any past result in one click.

GFP structure prediction

Completed

2m ago

Input: 238aa · Credits: 100 · Processing: 47.21s

KRAS docking — saquinavir

Processing...

8m ago

Input: 1 ligand · Credits: 20

Insulin fold

Completed

14m ago

Input: 110aa · Credits: 50 · Processing: 12.38s

Ubiquitin prediction

Completed

22m ago

Input: 76aa · Credits: 100 · Processing: 38.54s

Watch your job compute in real time

Elapsed time ticks live while your prediction runs. An estimated time remaining updates as the job progresses.

Output

Computing... (1m 23s)
~2m 15s remaining

Built by scientists for scientists

Trusted by leading institutions

Used by researchers at Harvard, Stanford, Thermo Fisher, Cambridge, and 40+ institutions worldwide.

Your data stays yours

Files are processed and deleted. We don't store your sequences or structures beyond your session.

GPU acceleration

Jobs run on NVIDIA B200, H200, & A100 GPUs. Get results in minutes, not days.

No setup, no queues

Upload your data, click run, download results. No installation, no dependencies, no waiting.

Try ProteinIQ now.