Getting started

Quickstart

This guide walks through the shortest path from account creation to a completed result, with the current job and credit behavior.

Use this guide to run your first tool with the current ProteinIQ workflow. By the end, you will know how to pick a tool, add input, check the credit cost, submit the run, and find the result again later.

Before you start

Sign in or create an account first. New accounts get a default personal workspace named My Workspace and start with 100 welcome credits.

Important

Free workspaces can submit up to 3 jobs per day. Paid plans remove that daily submission cap, but paid jobs still require enough credits to start.

Choose your first tool

Open /app/tools and start with a simple tool so you can learn the flow quickly.

  • PDB to FASTA: Convert a structure into one or more protein sequences
  • Protein Parameters: Calculate molecular weight, pI, and related sequence properties
  • ADMET-AI: Predict compound properties from SMILES input
  • AutoDock Vina: Run a docking workflow with receptor and ligand input

If you are new to the platform, start with PDB to FASTA or Protein Parameters before moving to heavier jobs.

Add input

Most tools accept one or more of these input styles:

  • Text input: Paste FASTA, SMILES, or other raw text directly into the tool
  • File upload: Upload supported file types such as .pdb, .cif, .fasta, or .sdf
  • External fetch: Retrieve data from supported external sources such as RCSB PDB, PubChem, or UniProt

For example, a FASTA input can look like this:

text
1>Protein12MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPK

The tool page determines which of these input methods are available.

Review settings and cost

Most tools work with their default settings, so you can often run them without changing anything on your first pass. Before you submit:

  1. Review the visible settings and optional advanced fields
  2. Check the credit badge beside the main action button
  3. Hover the badge to see the cost estimate and your remaining balance

If the tool shows 0 credits, that run is free. If it shows a paid cost, the workspace must have at least that many credits available.

Submit the run

Click the main action button on the tool page. Depending on the tool, that button may say Submit, Generate, or a tool-specific label.

After submission:

  1. Server-side tools create a job and show its current status
  2. Client-side tools return a result immediately in the browser
  3. Server-side jobs can usually be reopened later from the tool's History button or from /app/jobs

Review and download results

Once a job completes, inspect the output directly on the tool page. Depending on the tool, ProteinIQ can show tables, files, text output, or structure viewers.

You can usually do all of the following:

  • Review the result inline on the tool page
  • Open the job later from /app/jobs
  • Download available files or structured exports
  • Browse stored file artifacts from /app/files

If a paid job ends in Failed or Timeout, ProteinIQ refunds the credits automatically.

Find your work later

ProteinIQ keeps a few different entry points for previous runs and artifacts.

  • Tool page > History: Reopen runs for the current tool
  • /app/jobs: Review job history across the workspace
  • /app/files: Browse stored inputs and outputs
  • /app/settings/usage: Check balance and recent usage

Next steps

  • Introduction: Learn the core concepts behind tools, jobs, credits, and workspaces
  • Jobs: Understand statuses, retries, and sharing
  • Credits: See how charges, expirations, and refunds work
  • Pricing and billing: Understand plans, credits, and billing periods