TAP2 icon

TAP2

(2.0)

Contextualize antibody developability risks across hydrophobicity, charge patches, CDR length, and Fv charge symmetry. Learn more

What is TAP2?

TAP2 is a structure-informed antibody developability profiling method for paired heavy and light-chain variable domains. It reports total CDR length, surface hydrophobicity, positive and negative charge patches, Fv charge symmetry, and reference flags.

ProteinIQ runs an independent reconstruction of the published five-metric protocol. The TAP2 online guide covers the scientific background, reconstruction evidence, and experimental follow-up in detail.

How to use TAP2 online

Enter one complete antibody heavy-chain variable domain and one complete kappa or lambda light-chain variable domain. ProteinIQ builds an IMGT-numbered ABodyBuilder2 model, calculates the five TAP2 metrics, assigns fixed 2023 clinical-reference flags, and returns the profiled PDB with CSV, JSON, residue-level, PSA, and run-log files.

Inputs

InputAccepted contentRequirements
Heavy Chain (VH)Raw sequence, one FASTA record, or .fasta, .fa, or .txt fileOne complete VH domain, 70 to 180 standard amino acids; maximum file size 1 MB.
Light Chain (VL)Raw sequence, one FASTA record, or .fasta, .fa, or .txt fileOne complete kappa or lambda VL domain, 70 to 180 standard amino acids; maximum file size 1 MB.
Job nameTextOptional label for the run.

Each chain slot accepts one sequence. Remove signal peptides, constant regions, gaps, stop symbols, and ambiguous residues such as X. A paired FASTA with both chains in one slot is rejected.

Single-domain VHH sequences are not valid TAP2 inputs because the method requires both VH and VL. Use the Therapeutic Nanobody Profiler for VHH profiling.

Example input

The following example pair has passed repeated ProteinIQ validation runs.

Heavy chain (VH)

Text
EVQLVQSGGGLVKPGGSLRLSCAASGFTFSGYTMNWVRQAPGKGLEWVSGISGNSGIIEYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTALYYCAKDILGGFYYFDYWGQGTPVTVSS

Light chain (VL)

Text
VLTQSPLSLPVTLGQPASISCRSSQSLVFSDGNTYLHWFQQRPGQPPRRLIYQVSNRDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQVHSTFGPGTTVDIK

Repeated validation runs produced the following results. Surface scores can vary slightly because ABodyBuilder2 does not provide a fixed seed.

MetricValidation resultFlag
Total CDR length52Green
PSH146.8535 to 155.0102Green
PPC0.0039 to 0.0051Green
PNC0.1811 to 0.1852Green
SFvCSP0.0Green

Settings

TAP2 has no adjustable scientific settings. The fixed protocol keeps new results comparable with the published reference bands.

Protocol elementFixed value
Structure modelABodyBuilder2 from ImmuneBuilder 1.2
NumberingIMGT
HydrophobicityKyte-Doolittle scale normalized to values from 1 to 2
Surface exposurePSA side-chain relative accessibility of at least 7.5%
CDR vicinityExposed CDR anchors plus exposed residues within <4.0 Å
Patch neighborsOrdered residue pairs with a minimum heavy-atom distance of 7.5 Å or less
Charge modelAsp/Glu -1, Lys/Arg +1, and His +0.1 at pH 7.4
Reference settap2-cst-2023, the fixed 664-therapeutic set published with TAP2

Outputs

The result page separates the profile into three views.

ViewContents
StructureInteractive view of tap2_model.pdb. Per-residue ABodyBuilder2 error estimates are stored in the B-factor column.
MetricsCopyable table containing the five metrics, flags, supporting counts, exposed chain charges, salt bridges, and reference version.
FilesDownloadable structure, metric, residue, report, input, PSA, and log files.

Metric columns

ColumnMeaning
total_cdr_lengthNumber of residues in the six IMGT CDRs.
pshHydrophobic patch score in the modeled CDR vicinity.
ppcPositive-charge patch score in the CDR vicinity.
pncNegative-charge patch score in the CDR vicinity.
sfvcspProduct of the net exposed VH and VL charges.
*_flagGreen, amber, or red reference category for the corresponding metric.
surface_exposed_residuesNumber of residues that pass the surface-exposure cutoff.
cdr_vicinity_residuesNumber of exposed residues included in the CDR-vicinity calculation.
heavy_exposed_chargeNet charge across exposed VH residues.
light_exposed_chargeNet charge across exposed VL residues.
salt_bridgesNumber of detected salt bridges.
reference_versionReference bands used for the flags. Current results use tap2-cst-2023.

Downloadable files

FileContents
tap2_model.pdbRefined ABodyBuilder2 structure used for scoring.
tap2_metrics.csvOne-row metric, flag, charge, count, and reference summary.
tap2_residues.csvResidue-level IMGT positions, exposure, CDR membership, vicinity membership, charge, hydrophobicity, salt bridges, and model error.
tap2_report.jsonThresholds, metric definitions, runtime versions, sequence hashes, salt bridges, warnings, and limitations.
tap2_input.fastaNormalized VH and VL sequences used for modeling.
psa.outPSA 2.0 accessibility output used by the score calculation.
run.logMethod, runtime, result, warning, or failure details.

Understanding TAP2 results

Flags show where each modeled property falls relative to the fixed 2023 clinical-stage set. Green marks the central region, amber a tail, and red the outer region. They are reference categories, not pass-or-fail criteria.

MetricGreenAmberRed
Total CDR length42 &lt; value &lt; 5537 to 42 or 55 to 63&lt;37 or &gt;63
PSH110.11 &lt; value &lt; 168.0695.58 to 110.11 or 168.06 to 201.59&lt;95.58 or &gt;201.59
PPC&lt;1.321.32 to 4.22&gt;4.22
PNC&lt;2.002.00 to 4.42&gt;4.42
SFvCSP&gt;-6-30.60 to -6&lt;-30.60

Values exactly on a displayed boundary remain amber. PSH is two-sided, so unusually low and unusually high values can both receive alerts.

Result patternNext check
Metric near a boundaryRepeat the run and compare numeric values rather than colors alone.
Alert in a high-error CDRInspect the modeled structure before interpreting the surface geometry.
PSH, PPC, or PNC alertUse tap2_residues.csv to identify the contributing exposed residues.
Several alertsPlan orthogonal assays for the specific surface properties involved.

Troubleshooting

ProblemResolution
A chain is rejected as too short or longSubmit only the complete variable domain, between 70 and 180 residues.
A FASTA input reports multiple recordsKeep one VH record in the heavy slot and one VL record in the light slot.
The sequence contains unsupported residuesUse the 20 standard one-letter amino-acid codes without gaps, stops, or X.
VH and VL boundaries are uncertainCheck the domains with ANARCII before submission.
Scores move across repeated runsCompare the numeric values and model error. ABodyBuilder2 geometry can vary between runs.
Modeling or scoring failsOpen run.log for the failed stage, error code, and suggested correction.

How TAP2 works

ABodyBuilder2 predicts and refines an IMGT-numbered VH/VL structure. PSA identifies exposed side chains, and TAP2 calculates CDR length, hydrophobic and charged surface patches, and exposed chain-charge symmetry from that structure. The five values are then categorized against the fixed 2023 reference bands.

Important limitations

  • TAP2 flags describe reference-set position, not clinical success or experimental failure.
  • Scores depend on a predicted structure. Repeated models can differ, especially for PSH near a boundary.
  • The method profiles a paired Fv, not Fc behavior, full-length geometry, formulation conditions, or concentration effects.
  • The fixed tap2-cst-2023 bands can differ from services that use a newer reference population.
  • Expression, stability, viscosity, aggregation, self-interaction, and polyspecificity still require experimental measurement.

Table of contents

TAP2 icon

TAP2

(2.0)

Contextualize antibody developability risks across hydrophobicity, charge patches, CDR length, and Fv charge symmetry. Learn more

What is TAP2?

TAP2 is a structure-informed antibody developability profiling method for paired heavy and light-chain variable domains. It reports total CDR length, surface hydrophobicity, positive and negative charge patches, Fv charge symmetry, and reference flags.

ProteinIQ runs an independent reconstruction of the published five-metric protocol. The TAP2 online guide covers the scientific background, reconstruction evidence, and experimental follow-up in detail.

How to use TAP2 online

Enter one complete antibody heavy-chain variable domain and one complete kappa or lambda light-chain variable domain. ProteinIQ builds an IMGT-numbered ABodyBuilder2 model, calculates the five TAP2 metrics, assigns fixed 2023 clinical-reference flags, and returns the profiled PDB with CSV, JSON, residue-level, PSA, and run-log files.

Inputs

InputAccepted contentRequirements
Heavy Chain (VH)Raw sequence, one FASTA record, or .fasta, .fa, or .txt fileOne complete VH domain, 70 to 180 standard amino acids; maximum file size 1 MB.
Light Chain (VL)Raw sequence, one FASTA record, or .fasta, .fa, or .txt fileOne complete kappa or lambda VL domain, 70 to 180 standard amino acids; maximum file size 1 MB.
Job nameTextOptional label for the run.

Each chain slot accepts one sequence. Remove signal peptides, constant regions, gaps, stop symbols, and ambiguous residues such as X. A paired FASTA with both chains in one slot is rejected.

Single-domain VHH sequences are not valid TAP2 inputs because the method requires both VH and VL. Use the Therapeutic Nanobody Profiler for VHH profiling.

Example input

The following example pair has passed repeated ProteinIQ validation runs.

Heavy chain (VH)

Text
EVQLVQSGGGLVKPGGSLRLSCAASGFTFSGYTMNWVRQAPGKGLEWVSGISGNSGIIEYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTALYYCAKDILGGFYYFDYWGQGTPVTVSS

Light chain (VL)

Text
VLTQSPLSLPVTLGQPASISCRSSQSLVFSDGNTYLHWFQQRPGQPPRRLIYQVSNRDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQVHSTFGPGTTVDIK

Repeated validation runs produced the following results. Surface scores can vary slightly because ABodyBuilder2 does not provide a fixed seed.

MetricValidation resultFlag
Total CDR length52Green
PSH146.8535 to 155.0102Green
PPC0.0039 to 0.0051Green
PNC0.1811 to 0.1852Green
SFvCSP0.0Green

Settings

TAP2 has no adjustable scientific settings. The fixed protocol keeps new results comparable with the published reference bands.

Protocol elementFixed value
Structure modelABodyBuilder2 from ImmuneBuilder 1.2
NumberingIMGT
HydrophobicityKyte-Doolittle scale normalized to values from 1 to 2
Surface exposurePSA side-chain relative accessibility of at least 7.5%
CDR vicinityExposed CDR anchors plus exposed residues within <4.0 Å
Patch neighborsOrdered residue pairs with a minimum heavy-atom distance of 7.5 Å or less
Charge modelAsp/Glu -1, Lys/Arg +1, and His +0.1 at pH 7.4
Reference settap2-cst-2023, the fixed 664-therapeutic set published with TAP2

Outputs

The result page separates the profile into three views.

ViewContents
StructureInteractive view of tap2_model.pdb. Per-residue ABodyBuilder2 error estimates are stored in the B-factor column.
MetricsCopyable table containing the five metrics, flags, supporting counts, exposed chain charges, salt bridges, and reference version.
FilesDownloadable structure, metric, residue, report, input, PSA, and log files.

Metric columns

ColumnMeaning
total_cdr_lengthNumber of residues in the six IMGT CDRs.
pshHydrophobic patch score in the modeled CDR vicinity.
ppcPositive-charge patch score in the CDR vicinity.
pncNegative-charge patch score in the CDR vicinity.
sfvcspProduct of the net exposed VH and VL charges.
*_flagGreen, amber, or red reference category for the corresponding metric.
surface_exposed_residuesNumber of residues that pass the surface-exposure cutoff.
cdr_vicinity_residuesNumber of exposed residues included in the CDR-vicinity calculation.
heavy_exposed_chargeNet charge across exposed VH residues.
light_exposed_chargeNet charge across exposed VL residues.
salt_bridgesNumber of detected salt bridges.
reference_versionReference bands used for the flags. Current results use tap2-cst-2023.

Downloadable files

FileContents
tap2_model.pdbRefined ABodyBuilder2 structure used for scoring.
tap2_metrics.csvOne-row metric, flag, charge, count, and reference summary.
tap2_residues.csvResidue-level IMGT positions, exposure, CDR membership, vicinity membership, charge, hydrophobicity, salt bridges, and model error.
tap2_report.jsonThresholds, metric definitions, runtime versions, sequence hashes, salt bridges, warnings, and limitations.
tap2_input.fastaNormalized VH and VL sequences used for modeling.
psa.outPSA 2.0 accessibility output used by the score calculation.
run.logMethod, runtime, result, warning, or failure details.

Understanding TAP2 results

Flags show where each modeled property falls relative to the fixed 2023 clinical-stage set. Green marks the central region, amber a tail, and red the outer region. They are reference categories, not pass-or-fail criteria.

MetricGreenAmberRed
Total CDR length42 &lt; value &lt; 5537 to 42 or 55 to 63&lt;37 or &gt;63
PSH110.11 &lt; value &lt; 168.0695.58 to 110.11 or 168.06 to 201.59&lt;95.58 or &gt;201.59
PPC&lt;1.321.32 to 4.22&gt;4.22
PNC&lt;2.002.00 to 4.42&gt;4.42
SFvCSP&gt;-6-30.60 to -6&lt;-30.60

Values exactly on a displayed boundary remain amber. PSH is two-sided, so unusually low and unusually high values can both receive alerts.

Result patternNext check
Metric near a boundaryRepeat the run and compare numeric values rather than colors alone.
Alert in a high-error CDRInspect the modeled structure before interpreting the surface geometry.
PSH, PPC, or PNC alertUse tap2_residues.csv to identify the contributing exposed residues.
Several alertsPlan orthogonal assays for the specific surface properties involved.

Troubleshooting

ProblemResolution
A chain is rejected as too short or longSubmit only the complete variable domain, between 70 and 180 residues.
A FASTA input reports multiple recordsKeep one VH record in the heavy slot and one VL record in the light slot.
The sequence contains unsupported residuesUse the 20 standard one-letter amino-acid codes without gaps, stops, or X.
VH and VL boundaries are uncertainCheck the domains with ANARCII before submission.
Scores move across repeated runsCompare the numeric values and model error. ABodyBuilder2 geometry can vary between runs.
Modeling or scoring failsOpen run.log for the failed stage, error code, and suggested correction.

How TAP2 works

ABodyBuilder2 predicts and refines an IMGT-numbered VH/VL structure. PSA identifies exposed side chains, and TAP2 calculates CDR length, hydrophobic and charged surface patches, and exposed chain-charge symmetry from that structure. The five values are then categorized against the fixed 2023 reference bands.

Important limitations

  • TAP2 flags describe reference-set position, not clinical success or experimental failure.
  • Scores depend on a predicted structure. Repeated models can differ, especially for PSH near a boundary.
  • The method profiles a paired Fv, not Fc behavior, full-length geometry, formulation conditions, or concentration effects.
  • The fixed tap2-cst-2023 bands can differ from services that use a newer reference population.
  • Expression, stability, viscosity, aggregation, self-interaction, and polyspecificity still require experimental measurement.

Table of contents

Related tools

TNP

TNP

Profile nanobody developability with the Therapeutic Nanobody Profiler, including CDR geometry, surface hydrophobicity and charge, clinical-reference flags, and predicted structures.

protein-analysisproperty-prediction+4
Chou-Fasman

Chou-Fasman

Predict protein secondary structure using the classic Chou-Fasman algorithm based on amino acid propensities

protein-analysisstructure-prediction+2
AbLang-2

AbLang-2

Antibody-specific language model for predicting non-germline residues (NGL) in antibody sequences. AbLang-2 addresses germline bias in existing antibody language models by focusing on somatic hypermutation patterns, enabling more accurate prediction of amino acid likelihoods and generation of context-aware embeddings for antibody sequences.

sequence-analysisai-powered+5
DeepSP

DeepSP

Predict 30 antibody spatial descriptors from paired heavy- and light-chain variable-domain sequences, including SAP-positive and positive/negative SCM values across CDR and variable-domain regions.

protein-analysisdeep-learning+2
DeepViscosity

DeepViscosity

Classify paired monoclonal antibody Fv sequences as low viscosity (at or below 20 cP) or high viscosity (above 20 cP) at 150 mg/mL, with ensemble probabilities and 30 DeepSP descriptors.

protein-analysisdeep-learning+2
PolyXpert

PolyXpert

Predict low or high antibody polyreactivity from paired VH and VL variable-domain sequences with the source PolyXpert ESM-2 classifier.

antibodytherapeutics+5
DeepImmuno

DeepImmuno

Score peptide-HLA immunogenicity, rank the official HLA panel, or generate candidate peptides with the pinned DeepImmuno models.

protein-analysisdeep-learning+3
IgGM

IgGM

IgGM is a generative foundation model for antibody and nanobody design against a target antigen. Supports CDR design, affinity maturation, inverse design, and framework design. Requires an antigen structure (PDB) and antibody sequences with "X" marking positions to design.

protein-designantibody-design+5
ProstT5

ProstT5

ProstT5 is a protein language model that bidirectionally translates between amino acid sequences and 3Di structural tokens. It enables fast structure-based searches and inverse folding by encoding structural information into a sequence-like representation.

structure-predictionsequence-analysis+3
RNAcofold

RNAcofold

RNAcofold predicts the joint secondary structure of two interacting RNA molecules and optionally reports partition-function and concentration-dependent equilibrium metrics.

sequence-analysisstructure-prediction+3