Protein-Sol

Predict protein solubility from sequence with feature-level and windowed profile outputs.

Input

Job name

Protein sequences

1 credit

Configure input settings on the left, then click "Predict solubility"orLoad an example (it's free)

Lysozyme-like sequence

What is Protein-Sol?

Protein-Sol predicts protein solubility directly from amino acid sequence. It reports the same core quantities described by the University of Manchester method: percent-sol, scaled-sol, population-sol, and predicted pI.

The method calculates sequence features such as charge balance, amino acid composition, Kyte-Doolittle hydropathy, fold propensity, disorder propensity, entropy, and beta propensity. These features are compared with the Niwa cell-free expression solubility dataset to estimate solubility.

Input Requirements

Protein-Sol accepts protein sequences in FASTA format. Each sequence must include a header line beginning with > and at least 21 standard amino acid residues, because the method calculates sliding 21-residue profiles.

Use the 20 standard one-letter amino acid codes when possible:

Text

>my_protein
MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQLR

Protein-Sol ignores stop symbols and characters outside the standard amino acid alphabet during its sequence preparation step. For clean, reproducible predictions, submit canonical protein FASTA records.

Results

Protein-Sol returns a single file list of CSV outputs. The main predictions CSV contains one row per accepted sequence:

percent-sol: predicted solubility percentage.
scaled-sol: prediction scaled over the source reference range.
population-sol: reference population solubility on the same scale.
pI: predicted isoelectric point used by the Protein-Sol feature model.

The file list also includes CSV downloads for feature weights, feature deviations, sliding-window profiles, and whole-sequence/windowed composition data.

Downloadable Files

Protein-Sol returns CSV tables for the parsed results:

predictions.csv: solubility predictions and predicted pI.
feature_weights.csv: feature contribution weights used by the model.
feature_deviations.csv: sequence feature deviations.
profiles.csv: 21-residue window profile values.
composition.csv: whole-sequence and windowed composition features.
composition_summaries.csv: composition summary lines.

Generated run files are retained with the result download bundle:

seq_prediction.txt: prediction rows, feature weights, deviations, and 21-residue profiles.
seq_composition.txt: whole-sequence, 21-residue, and 51-residue composition features.
run.log: execution log.
messages.txt: parser messages when Protein-Sol reports skipped or adjusted input records.

Citation

Hebditch M, Carballo-Amador MA, Charonis S, Curtis R, Warwicker J. Protein-Sol: a web tool for predicting protein solubility from sequence. Bioinformatics. 2017;33(19):3098-3100. doi:10.1093/bioinformatics/btx345

Related tools

Protein stability

Predict protein stability using validated BioPython methods: Instability Index, Aliphatic Index, GRAVY, flexibility analysis, and charge distribution

ThermoMPNN

Predict protein thermostability changes (ΔΔG) for point mutations using a graph neural network. Enables computational saturation mutagenesis screening to identify stabilizing mutations.

Aggrescan3D

Faithful static-mode Aggrescan3D tool for per-residue aggregation propensity analysis from a single protein structure.

AllMetal3D

Predict metal and water binding sites in protein structures using 3D convolutional neural networks (AllMetal3D + Water3D).

PROPKA 3

Predict pKa values of ionizable groups in proteins and protein-ligand complexes from 3D structure. PROPKA calculates environment-driven pKa shifts for standard ionizable residues, terminal groups, and supported ligand atom types.

SuperWater

Predict protein hydration sites from a structure using a diffusion model with ESM features and a confidence-filtering head.

AbLang

Restore missing residues in antibody sequences using a language model trained on the Observed Antibody Space (OAS) database. Achieves better restoration than IMGT germlines or ESM-1b while being 7x faster.

IPC 2.0 (isoelectric point calculator)

Isoelectric Point Calculator 2.0 - Predict protein/peptide isoelectric point (pI) using 18+ validated pKa scales, SVR models, and deep learning. Supports proteins, peptides, and comprehensive analysis.

ORF Finder

Find all Open Reading Frames (ORFs) in DNA sequences. Searches all six reading frames and supports multiple genetic codes.

Molecular descriptors

Compute 200+ RDKit molecular descriptors, drug-likeness rule violations, and structural fingerprints for QSAR, virtual screening, and ML workflows

What is Protein-Sol?

Input Requirements

Use the 20 standard one-letter amino acid codes when possible:

Text

>my_protein
MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQLR

Results

Protein-Sol returns a single file list of CSV outputs. The main predictions CSV contains one row per accepted sequence:

percent-sol: predicted solubility percentage.

scaled-sol: prediction scaled over the source reference range.

population-sol: reference population solubility on the same scale.

pI: predicted isoelectric point used by the Protein-Sol feature model.

The file list also includes CSV downloads for feature weights, feature deviations, sliding-window profiles, and whole-sequence/windowed composition data.

Downloadable Files

Protein-Sol returns CSV tables for the parsed results:

predictions.csv: solubility predictions and predicted pI.

feature_weights.csv: feature contribution weights used by the model.

feature_deviations.csv: sequence feature deviations.

profiles.csv: 21-residue window profile values.

composition.csv: whole-sequence and windowed composition features.

composition_summaries.csv: composition summary lines.

Generated run files are retained with the result download bundle:

seq_prediction.txt: prediction rows, feature weights, deviations, and 21-residue profiles.

seq_composition.txt: whole-sequence, 21-residue, and 51-residue composition features.

run.log: execution log.

messages.txt: parser messages when Protein-Sol reports skipped or adjusted input records.