Configure inputs to begin
Set options on the left, then click “Align Sequences”.

Perform multiple sequence alignment using MAFFT (Multiple Alignment using Fast Fourier Transform). Supports multiple algorithms from fast progressive to highly accurate iterative methods.

Ultra-fast sequence search and clustering. 10,000x faster than BLAST for database searches, with powerful sequence clustering capabilities for proteins and nucleotides.

USAlign (Universal Structure Alignment) aligns protein, RNA, and DNA structures to compute TM-scores and generate superposed structures. Compare 3D structures to assess structural similarity.

Perform multiple sequence alignment on protein or nucleotide sequences using the Clustal Omega algorithm.

Infer approximately-maximum-likelihood phylogenetic trees from alignments of nucleotide or protein sequences.

Build phylogenetic trees using maximum likelihood with automatic model selection (ModelFinder) and ultrafast bootstrap support.

Sensitive sequence homology search using profile hidden Markov models. More accurate than BLAST for detecting remote homologs, ideal for finding evolutionarily distant protein family members.

Rapidly align and compare DNA sequences using MUMmer4 nucmer. Perform pairwise genome comparisons to identify SNPs, indels, and structural variants between reference and query genomes.

Analyze immunoglobulin (antibody) and T cell receptor variable domain sequences. Identifies V/D/J gene segments, delineates CDR regions, and analyzes rearrangement junctions.

Fast protein structure search, comparison, and clustering. Search your structure against 200M+ AlphaFold predictions, compare 2 structures, or cluster up to 2500.
MUSCLE5 is a high-accuracy multiple sequence alignment tool that aligns protein and nucleotide sequences to reveal evolutionary relationships and functional similarities. It uses the PPP (Profile-to-Profile) algorithm to progressively build alignments from the most similar sequences outward, achieving better accuracy than comparable tools like Clustal Omega and MAFFT.
A key innovation in MUSCLE5 is its ability to generate alignment ensembles—multiple alternative alignments of the same sequences with different systematic biases. This lets you assess how robust downstream analyses (like phylogenetic trees or structure predictions) are to alignment uncertainty. Rather than committing to a single alignment that might be wrong, you can test whether your conclusions hold across many plausible alignments.
MUSCLE5 uses progressive alignment, a two-step process. First, it estimates a guide tree that shows which sequences are most similar to each other. Then it aligns sequences step-by-step from the leaves of the tree toward the root, combining two sequences or profiles at each step.
The reason this works is that alignment accuracy depends critically on alignment order. Aligning closely-related sequences first creates a stable foundation, then adding more distant sequences becomes easier. This is more efficient than trying to align all sequences at once (which would be computationally intractable for large datasets).
The guide tree determines the alignment order. A better tree generally produces a better alignment, but no single tree is perfect—a tree that works well near the root might make poor decisions about how to align divergent sequences.
MUSCLE5 addresses this by generating an ensemble of alignments using different guide tree orderings. By permuting the tree in systematic ways—swapping which sequences are aligned first—the algorithm generates multiple alignments with different biases. All replicates have approximately equal accuracy on benchmarks, meaning there is no single "best" alignment.
The PPP algorithm performs profile-to-profile alignment using dynamic programming. Each profile is a matrix encoding the likelihood of each amino acid (or nucleotide) at each position, derived from a multiple alignment of related sequences.
For large datasets, MUSCLE5 switches to an approximation: instead of comparing all profile pairs, it randomly samples sequence pairs and aligns them, which is much faster while maintaining similar accuracy.
You can generate ensembles in two ways:
Stratified ensembles create replicates by permuting the guide tree four times (none, abc, acb, bca), each producing an alignment with different systematic errors. This is fast because it uses the same HMM parameters.
Diversified ensembles generate many more replicates by perturbing the HMM in addition to permuting the guide tree. This increases diversity but takes longer. We recommend diversified ensembles if you want to thoroughly assess robustness.
Sequence format: MUSCLE5 accepts FASTA format, the standard for sequence data. Each sequence starts with > followed by a name, then one or more lines of sequence.
Example:
>human_insulin
MALWMRLLPLLAVTFLAGCGAKSQVQLVESGGGLVQPGGSLRLSCAASGFTFSGYY
>mouse_insulin
MALWMRLLPLLAVTFLAGCGAKSSVQLLESGGGLVQPGGSLRLSCAASGFTFSGYY
>zebrafish_insulin
MQLWMRLPPLAVTFLVLCGAKSSVQLVESGGGLVQPGGSLRLSCAASGFTFSGYYSequence type: Choose Protein, DNA, or RNA, or let MUSCLE5 auto-detect. Auto-detection works by counting nucleotide characters (A, C, G, T, U) in a sample of your sequences.
Threads: For large datasets (hundreds of sequences), increase thread count to speed up alignment. Each thread processes independently, so the wall-clock time improves roughly linearly with threads.
MUSCLE5 outputs an aligned FASTA file where all sequences have the same length. Gaps (represented by dashes -) indicate insertions or deletions relative to the alignment.
Alignment statistics shown after running include:
If you generated an ensemble, you receive multiple alignments. Compare how conserved regions look across replicates—if they're consistent, your conclusions should be robust. If key regions vary between replicates, the alignment is uncertain in those regions.
We recommend MUSCLE5 when accuracy is important and runtime is not a constraint. MUSCLE5 ranks among the top performers on benchmarks and handles large datasets efficiently with multi-threading.
Use MUSCLE5 especially when you need to:
For very quick alignments of small datasets where a few percentage points of accuracy matter less than speed, MAFFT with the FFT-NS-2 algorithm is faster.
Progressive alignment assumes that closely-related sequences should align before divergent ones. This breaks down with very heterogeneous sequence families where no clear hierarchical structure exists.
MUSCLE5 aligns sequences but does not predict structures or functional annotations—use it to establish evolutionary relationships, then analyze results with specialized structure or function tools.
Alignment quality depends heavily on sequence similarity. If your sequences share less than 20% identity outside small functional domains, any alignment (including MUSCLE5's) becomes increasingly uncertain.
Clustal Omega is slightly faster and provides multiple output formats, making it good for general-purpose alignment. MAFFT offers a speed-accuracy tradeoff with multiple algorithms to choose from. MUSCLE5 prioritizes accuracy and provides ensemble generation for robustness testing, at the cost of longer runtime.
For sequence homology search and alignment of many sequences against a database, use MMseqs2 instead—it's specifically optimized for that task.