
Calculate the aliphatic index of protein sequences to assess thermostability Learn more
Input
How to calculate a protein's aliphatic index
Paste a protein sequence, or several FASTA records, and ProteinIQ calculates one aliphatic index for each sequence. The result measures the sequence share of alanine, valine, isoleucine, and leucine, weighted by side-chain volume. Use it to compare proteins or variants on the same sequence-level scale, then download or copy the results table.
For example, these are the mature human insulin chains:
>insulin-B human insulin B chain
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
>insulin-A human insulin A chain
GIVEQCCTSICSLYQLENYCNThe calculation returns:
| Protein ID | Amino acids | Aliphatic index |
|---|---|---|
| insulin-B | 30 | 84.33 |
| insulin-A | 21 | 88.1 |
The value includes every residue in the sequence length. For example, a residue that is not A, V, I, or L contributes zero to the numerator, but still contributes to the denominator.
Input
| Input | Accepted by the tool |
|---|---|
| Pasted sequence | A single protein sequence in one-letter code, with or without a FASTA header |
| Batch input | One or more FASTA records. Each header starts with > and is followed by its sequence. |
| Uploads | .txt, .csv, .fasta, .fa, .fas, and .pdb files up to 50 MB |
| Structure lookup | A protein sequence fetched from RCSB in FASTA format |
| Protein alphabet | The 20 standard one-letter amino acid codes: A R N D C Q E G H I L K M F P S T W Y V |
Sequence lines are joined, whitespace is ignored, and lowercase amino acid codes are converted to uppercase. At processing time, a sequence containing a non-standard residue is rejected. For FASTA input, use a concise first header field when the identifier matters: >insulin-B human insulin B chain appears as insulin-B in the results table.
The per-job sequence limit follows the account tier: 1 for guests, 5 for Free, 1,000 for Lite, 10,000 for Plus, and 100,000 for Pro. Higher tiers have no configured item cap.
Settings
This calculator has no user-configurable settings. It always uses the Ikai coefficients of 2.9 for valine and 3.9 for isoleucine plus leucine.
Results
| Column | Meaning |
|---|---|
Protein ID | The first whitespace- or pipe-delimited field from the FASTA header. Plain-text input is labeled Sequence. |
Amino acids | Number of residues in the processed sequence. |
Aliphatic index | The calculated composition-based index for that sequence. |
The table is copyable and downloadable. Each submitted FASTA record produces one row, in the same order as the input.
What is the aliphatic index?
The aliphatic index estimates the relative volume occupied by the aliphatic side chains in a protein. It was introduced by Ikai as a sequence-derived property for comparing globular proteins, and is often used as one indicator when investigating thermal stability.
The calculation is:
Here, each is the mole percentage of that residue in the complete sequence. The weights mean that a given percentage of valine contributes 2.9 times as much as alanine, while isoleucine and leucine each contribute 3.9 times as much. A sequence made entirely of valine therefore has an index of 290, whereas one made entirely of isoleucine or leucine has an index of 390.
How should I interpret an aliphatic index?
Use the result as a comparative property, not a temperature prediction. A higher value means the sequence is more enriched in the four weighted aliphatic residues. That can be informative when comparing matched homologs, constructs, or single-site variants, especially when sequence length and protein class are similar.
It does not account for tertiary structure, oligomerization, disulfide bonds, cofactors, solvent conditions, pH, or post-translational modifications. A high index alone does not establish that a protein will express well, remain soluble, or tolerate a particular temperature. For a mutation series, compare the index with measured stability and other sequence properties rather than treating a cutoff as a pass or fail rule.
Which protein property tool should I use?
| Goal | Tool |
|---|---|
| Compare the A, V, I, and L side-chain contribution between sequences | Aliphatic Index |
| Inspect the complete amino acid distribution before interpreting a difference | Amino Acid Composition |
| Measure overall hydropathy, which can help distinguish globally hydrophobic proteins from soluble ones | GRAVY |
| Estimate sequence-based in vitro instability from dipeptide composition | Instability Index |
| Calculate several basic protein properties in one table | Protein Parameters |
FAQ
What amino acids are used in the aliphatic index?
Alanine, valine, isoleucine, and leucine. Their mole percentages are weighted as 1.0, 2.9, 3.9, and 3.9, respectively; all other residues affect the sequence length but add no weighted contribution.
Is a higher aliphatic index always better?
No. It only indicates greater representation of the weighted aliphatic residues. Whether that is desirable depends on the protein, target conditions, and trade-offs with folding, solubility, activity, and expression.
Can I calculate the aliphatic index for multiple proteins at once?
Yes. Paste multiple FASTA records or upload a supported file. ProteinIQ preserves their input order and reports one result row per valid submitted sequence.
Why does my FASTA header look different in the output?
The results table uses the first token in the header, stopping at whitespace or |. Name a record >variant-7 description when variant-7 is the identifier you want to compare and export.
Related tools

Extinction coefficient calculator
Calculate the molar extinction coefficient of protein sequences at 280 nm. Used for protein concentration determination by UV spectroscopy.

Glycosylation site finder
Find potential N-linked glycosylation sites (NX[S/T] sequons) in protein sequences. Identifies asparagine residues in the consensus motif for N-glycosylation.

GRAVY
Calculate the GRAVY (Grand Average of Hydropathy) score of protein sequences. Positive values indicate hydrophobic proteins, negative values indicate hydrophilic proteins.

Instability Index
Calculate the instability index of protein sequences. Values above 40 indicate an unstable protein with a short half-life in vitro.

Protein molecular weight calculator
Calculate protein molecular weight from amino acid sequences in Daltons and kilodaltons. Supports FASTA and CSV input, average or monoisotopic masses, initiator Met removal, and disulfide correction.

pI Calculator
Calculate the theoretical isoelectric point (pI) of protein sequences. The pI is the pH at which a protein carries no net electrical charge.

Amino acid composition
Analyze amino acid composition of protein sequences. The tool accepts FASTA sequences and outputs the percentage of each amino acid in the sequence.

Protein motif scanner
Scan protein sequences for biologically important motifs including glycosylation sites, phosphorylation sites, nuclear localization signals, prenylation motifs, and more.

InterPro Download
Download InterPro protein family and domain records as JSON by InterPro ID.

QuickGO Download
Download QuickGO Gene Ontology term records as JSON by GO ID.